PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy016530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 154aa    MW: 17499 Da    PI: 9.9523
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S54138660PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY63.14.9e-20120153134
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT--- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpv 34 
                ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+v
  Ahy016530 120 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRV 153
                59******************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-21105153IPR003657WRKY domain
SuperFamilySSF1182901.11E-18112153IPR003657WRKY domain
PROSITE profilePS5081119.393115154IPR003657WRKY domain
SMARTSM007742.7E-9120153IPR003657WRKY domain
PfamPF031063.5E-15121153IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
XFVQFEENHL LGFLSPTSSQ SQSSQLSQSL DAATILATTT TPATIATTTA TTKNWHHKQV  60
GTLDPKAMND ENCTGNSSEG NNNITWWKSS AATEKNKVKM RRKLREPRFC FQTRSDVDVL  120
DDGYKWRKYG QKVVKNSLHP RSYYRCTHSN CRVX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-15111153850Probable WRKY transcription factor 4
1wj2_A2e-15111153850Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016196127.11e-87PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY43e-43WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0B2S8F62e-65A0A0B2S8F6_GLYSO; Putative WRKY transcription factor 12
STRINGGLYMA07G13611.13e-59(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-42WRKY family protein